PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022113t1
Common NameTCM_022113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family S1Fa-like
Protein Properties Length: 83aa    MW: 9052.81 Da    PI: 10.4756
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022113t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA133.45.8e-421782570
              S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                      ++eakG+nPGlivllvv glllvflvgny+ly yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe
  Thecc1EG022113t1 17 ETEAKGFNPGLIVLLVVVGLLLVFLVGNYALYLYAQKSLPPRKKKPVSKKKMKKERLKQGVSAPGE 82
                      78***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.5E-401882IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MSAEFEIGDK GNKISYETEA KGFNPGLIVL LVVVGLLLVF LVGNYALYLY AQKSLPPRKK  60
KPVSKKKMKK ERLKQGVSAP GE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027283.11e-51S1FA-like DNA-binding protein
SwissprotQ7XLX62e-18S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A061ERY51e-51A0A061ERY5_THECC; S1FA-like DNA-binding protein
STRINGSolyc09g007500.2.16e-20(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]